Chemistry
BufferPrep
Local Buffer Recipe Calculator
Calculate and scale common laboratory buffer recipes, stock dilutions, and molarity-to-mass steps directly in the browser.
bufferrecipesdilutionmolaritylab
Open toolLocal-first tools for researchers, students, and teachers.
Lab bench and classroom calculators, ready in your browser.
Prepare buffers, calculate dilutions, balance equations, and check scientific results with focused tools for chemistry, biology, physics, and math.
No account needed. Calculations run locally in your browser, with explanations to help you check your work.
Spotlight
Featured scientific tools
A quick launchpad for the most immediately useful calculators and utilities currently live across StemGadgets.
Live
Physics
MotionSolve
Physics Kinematics and Dynamics Solver
Solve constant-acceleration motion and flat-surface friction problems with a local-first physics calculator and worked explanations.
physicskinematicsdynamicsfriction
Open toolBiology
SeqFlip
DNA/RNA Sequence Tool
Reverse, complement, reverse-complement, transcribe, and clean DNA/RNA sequences instantly in the browser.
DNARNAsequencemolecular biology
Open toolMath
SigFigPro
Scientific Notation and Significant Figures
Format numbers using significant figures, scientific notation, engineering notation, and round-half-to-even rules in the browser.
significant figuresscientific notationrounding
Open toolStatistics
ZShade
Z-Score to P-Value Calculator
Convert z-scores into left-tailed, right-tailed, and two-tailed probabilities with a browser-based standard normal calculator.
z-scorep-valuestatisticsnormal distribution
Open toolChemistry
pH Solver
pH, pOH, and Buffer Calculator
Work through pH, pOH, hydrogen ion concentration, weak acid/base equilibria, and buffer estimates with an interactive chemistry calculator.
pHbufferacidbasechemistry
Open toolChemistry
Molarity Calculator
Molarity and Dilution Calculator
Calculate molarity and dilution relationships across common lab units with a compact local-first calculator.
molaritydilutionsolutionlab
Open toolGeneral Science
UnitMatrix
Scientific Unit Converter Matrix
Convert scientific units across a real-time matrix for pressure, energy, length, volume, concentration, and more.
unitsconversionengineeringphysicslab
Open toolMath
MatrixLab Exact
Exact Fraction Matrix Calculator
Work through exact-fraction matrix arithmetic, determinant, inverse, RREF, rank, multiplication, and linear systems directly in the browser.
matrixlinear algebraRREFdeterminantinversefractions
Open toolDirectory
Browse all tools
10 tools listed · 10 live
Filter by category
Status legend: Live means available now. Coming soon means planned or under development.
Chemistry
BufferPrep
Local Buffer Recipe Calculator
Calculate and scale common laboratory buffer recipes, stock dilutions, and molarity-to-mass steps directly in the browser.
bufferrecipesdilutionmolaritylab
Open toolPhysics
MotionSolve
Physics Kinematics and Dynamics Solver
Solve constant-acceleration motion and flat-surface friction problems with a local-first physics calculator and worked explanations.
physicskinematicsdynamicsfriction
Open toolBiology
SeqFlip
DNA/RNA Sequence Tool
Reverse, complement, reverse-complement, transcribe, and clean DNA/RNA sequences instantly in the browser.
DNARNAsequencemolecular biology
Open toolMath
SigFigPro
Scientific Notation and Significant Figures
Format numbers using significant figures, scientific notation, engineering notation, and round-half-to-even rules in the browser.
significant figuresscientific notationrounding
Open toolStatistics
ZShade
Z-Score to P-Value Calculator
Convert z-scores into left-tailed, right-tailed, and two-tailed probabilities with a browser-based standard normal calculator.
z-scorep-valuestatisticsnormal distribution
Open toolChemistry
pH Solver
pH, pOH, and Buffer Calculator
Work through pH, pOH, hydrogen ion concentration, weak acid/base equilibria, and buffer estimates with an interactive chemistry calculator.
pHbufferacidbasechemistry
Open toolChemistry
Molarity Calculator
Molarity and Dilution Calculator
Calculate molarity and dilution relationships across common lab units with a compact local-first calculator.
molaritydilutionsolutionlab
Open toolChemistry
ChemBalancer
Chemical Equation Balancer
Balance chemical equations instantly in the browser using a focused interface for classroom and lab practice.
stoichiometryequationschemical reactionsbalancing
Open toolGeneral Science
UnitMatrix
Scientific Unit Converter Matrix
Convert scientific units across a real-time matrix for pressure, energy, length, volume, concentration, and more.
unitsconversionengineeringphysicslab
Open toolMath
MatrixLab Exact
Exact Fraction Matrix Calculator
Work through exact-fraction matrix arithmetic, determinant, inverse, RREF, rank, multiplication, and linear systems directly in the browser.
matrixlinear algebraRREFdeterminantinversefractions
Open toolWhy StemGadgets
Built for everyday STEM workflows, from quick classroom checks to lab bench calculations and lightweight research utilities.
Local-first
Many tools run directly in your browser without sending routine calculations to a server.
Built for science
Designed around real lab, classroom, and research workflows instead of generic templates.
Fast and focused
Each app solves a specific scientific task without unnecessary clutter or extra setup.
Growing library
New calculators and utilities will be added across STEM disciplines as the collection expands.
About
Built for everyday STEM workflows
StemGadgets is a growing collection of practical scientific web tools for students, researchers, teachers, and builders. The goal is to make everyday STEM calculations faster, clearer, and easier to use directly from the browser.
Read about the tools and how to report a correction.
Questions, feedback, or correction requests can be sent to [email protected]. StemGadgets is based in California, USA.
Next up
More tools coming soon
Planned additions include chemistry calculators, physics solvers, statistical tools, and more compact utilities for teaching, studying, and research support.